PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67395.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 27777.5 Da    PI: 7.3662
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67395.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-26959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krien++ rqvtfskRr g++KK +ELSvLCda++ +i+fs++gkl ey++
  EPS67395.1  9 KRIENTTSRQVTFSKRRSGLIKKTHELSVLCDAQIGLIVFSTKGKLTEYCT 59
                79***********************************************96 PP

2K-box61.14.4e-21931751496
       K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                 +e+++qela++k+e+ nL+ ++ ++ G+dL+s ++ eL +Le+qLe+s +kiR++K +ll+eq+++l++ e +l++en+++ +
  EPS67395.1  93 NEQMYQELARMKNETMNLELSLQRYRGDDLSSVQFDELSELENQLEHSANKIRTRKFQLLHEQLDNLKRTEGMLEKENQEMYQ 175
                 689****************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.768161IPR002100Transcription factor, MADS-box
CDDcd002652.09E-42276No hitNo description
SuperFamilySSF554557.19E-31283IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2193176IPR002487Transcription factor, K-box
PROSITE profilePS5129714.77693188IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRGKLEVKR IENTTSRQVT FSKRRSGLIK KTHELSVLCD AQIGLIVFST KGKLTEYCTP  60
PYSMKQIIDR YSKAKGIHIP DHNAPGSSMG LYNEQMYQEL ARMKNETMNL ELSLQRYRGD  120
DLSSVQFDEL SELENQLEHS ANKIRTRKFQ LLHEQLDNLK RTEGMLEKEN QEMYQWLMSN  180
QLQKQAEAVE NDHHHQQEMP PELKLLEQQP HHFPFFRDDL QLGTLPFPNS SYRLQVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-15272169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15272169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15272169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-15272169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S2e-15172170Myocyte-specific enhancer factor 2B
1tqe_R2e-15172170Myocyte-specific enhancer factor 2B
1tqe_Q2e-15172170Myocyte-specific enhancer factor 2B
1tqe_P2e-15172170Myocyte-specific enhancer factor 2B
3p57_J2e-15272169Myocyte-specific enhancer factor 2A
3p57_I2e-15272169Myocyte-specific enhancer factor 2A
3p57_D2e-15272169Myocyte-specific enhancer factor 2A
3p57_C2e-15272169Myocyte-specific enhancer factor 2A
3p57_B2e-15272169Myocyte-specific enhancer factor 2A
3p57_A2e-15272169Myocyte-specific enhancer factor 2A
3kov_J2e-15272169Myocyte-specific enhancer factor 2A
3kov_I2e-15272169Myocyte-specific enhancer factor 2A
3kov_B2e-15272169Myocyte-specific enhancer factor 2A
3kov_A2e-15272169Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843283.11e-116PREDICTED: MADS-box protein defh21
SwissprotQ8RVL41e-109DEF21_ANTMA; MADS-box protein defh21
TrEMBLS8CL111e-178S8CL11_9LAMI; Uncharacterized protein
STRINGSolyc11g005120.1.14e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.27e-63MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]